galectin 9 (LGALS9) (NM_009587) Human Mass Spec Standard
CAT#: PH319435
LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_033665)
View other "galectin 9" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_033665) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219435 |
| Predicted MW | 39.3 kDa |
| Protein Sequence |
>RC219435 representing NM_009587
Red=Cloning site Green=Tags(s) MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGG YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSV QLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFST PAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRN TQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL THVQT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_033665 |
| RefSeq Size | 1696 |
| RefSeq ORF | 1065 |
| Synonyms | HUAT; LGALS9A |
| Locus ID | 3965 |
| Cytogenetics | 17q11.2 |
| Summary | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419406 | LGALS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419406 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 2 |
CNY 3080.00 |
|
| PH310750 | LGALS9 MS Standard C13 and N15-labeled recombinant protein (NP_002299) |
CNY 19520.00 |
|
| TP310750 | Recombinant protein of human lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP319435 | Purified recombinant protein of Homo sapiens lectin, galactoside-binding, soluble, 9 (LGALS9), transcript variant 1, 20 µg |
CNY 2900.00 |
其它galectin 9产品
