CD272 (BTLA) (NM_181780) Human Mass Spec Standard
CAT＃: PH319458
BTLA MS Standard C13 and N15-labeled recombinant protein (NP_861445)
View other "CD272" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | BTLA MS Standard C13 and N15-labeled recombinant protein (NP_861445) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219458 |
| Predicted MW | 32.6 kDa |
| Protein Sequence |
>RC219458 representing NM_181780
Red=Cloning site Green=Tags(s) MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVT WCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSAS ERPSKDEMASRPWLLYSLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEA STRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGLNSRLARNVKEAPT EYASICVRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_861445 |
| RefSeq Size | 1239 |
| RefSeq ORF | 867 |
| Synonyms | BTLA1; CD272 |
| Locus ID | 151888 |
| Cytogenetics | 3q13.2 |
| Summary | This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. [provided by RefSeq, Aug 2011] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403628 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421272 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425974 | BTLA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403628 | Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 1 |
CNY 3080.00 |
|
| LY421272 | Transient overexpression lysate of B and T lymphocyte associated (BTLA), transcript variant 2 |
CNY 3080.00 |
|
| TP319458 | Recombinant protein of human B and T lymphocyte associated (BTLA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP700213 | Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells |
CNY 6650.00 |
|
| TP700215 | Purified recombinant protein of Human B and T lymphocyte associated protein (BTLA), with C-terminal DDK/His tag, expressed in human cells |
CNY 6650.00 |
|
| TP720688 | Purified recombinant protein of Human B and T lymphocyte associated (BTLA), transcript variant 1 |
CNY 1800.00 |
|
| TP723966 | Human BTLA Protein, mFc-His Tag |
CNY 5249.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
