TGF beta Receptor I (TGFBR1) (NM_004612) Human Mass Spec Standard
CAT#: PH319514
TGFBR1 MS Standard C13 and N15-labeled recombinant protein (NP_004603)
View other "TGF beta Receptor I" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TGFBR1 MS Standard C13 and N15-labeled recombinant protein (NP_004603) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219514 |
| Predicted MW | 55.96 kDa |
| Protein Sequence |
>RC219514 representing NM_004612
Red=Cloning site Green=Tags(s) MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSM CIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCIS LMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRTIARTIVLQES IGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVS DYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIA DLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKK TLSQLSQQEGIKM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004603 |
| RefSeq Size | 6475 |
| RefSeq ORF | 1509 |
| Synonyms | AAT5; ACVRLK4; ALK-5; ALK5; ESS1; LDS1; LDS1A; LDS2A; MSSE; SKR4; tbetaR-I; TBR-i; TBRI; TGFR-1 |
| Locus ID | 7046 |
| Cytogenetics | 9q22.33 |
| Summary | The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
| Protein Pathways | Adherens junction, Chronic myeloid leukemia, Colorectal cancer, Cytokine-cytokine receptor interaction, Endocytosis, MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401457 | TGFBR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401457 | Transient overexpression lysate of transforming growth factor, beta receptor 1 (TGFBR1), transcript variant 1 |
CNY 4840.00 |
|
| TP319514 | Recombinant protein of human transforming growth factor, beta receptor 1 (TGFBR1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它TGF beta Receptor I产品
