MZT2A (NM_001085365) Human Mass Spec Standard
CAT#: PH319963
FAM128A MS Standard C13 and N15-labeled recombinant protein (NP_001078834)
View other "MZT2A" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
| Product Data | |
| Description | FAM128A MS Standard C13 and N15-labeled recombinant protein (NP_001078834) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219963 |
| Predicted MW | 12.5 kDa |
| Protein Sequence |
>RC219963 representing NM_001085365
Red=Cloning site Green=Tags(s) MELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRG RDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001078834 |
| RefSeq Size | 708 |
| RefSeq ORF | 363 |
| Synonyms | FAM128A; MOZART2A |
| Locus ID | 653784 |
| Cytogenetics | 2q21.1 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421274 | MZT2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421274 | Transient overexpression lysate of family with sequence similarity 128, member A (FAM128A) |
CNY 3080.00 |
|
| TP319963 | Recombinant protein of human family with sequence similarity 128, member A (FAM128A), 20 µg |
CNY 2900.00 |
|
| TP710150 | Purified protein of Homo sapiens mitotic spindle organizing protein 2A (MZT2A), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
