BFSP2 (NM_003571) Human Mass Spec Standard
CAT#: PH319996
BFSP2 MS Standard C13 and N15-labeled recombinant protein (NP_003562)
View other "BFSP2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | BFSP2 MS Standard C13 and N15-labeled recombinant protein (NP_003562) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219996 |
| Predicted MW | 45.9 kDa |
| Protein Sequence |
>RC219996 protein sequence
Red=Cloning site Green=Tags(s) MSERRVVVDLPTSASSSMPLQRRRASFRGPRSSSSLESPPASRTNAMSGLVRAPGVYVGTAPSGCIGGLG ARVTRRALGISSVFLQGLRSSGLATVPAPGLERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQLRMHL ESKATRSGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLY KVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILETIRIQWE RDVEKNRVEAGALLQAKQQAEVAHMSQTQEEKLAAALRVELHNTSCQVQSLQAETESLRALKRGLENTLH DAKHWHDMELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDREESG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003562 |
| RefSeq Size | 1595 |
| RefSeq ORF | 1245 |
| Synonyms | CP47; CP49; CTRCT12; LIFL-L; PHAKOSIN |
| Locus ID | 8419 |
| Cytogenetics | 3q22.1 |
| Summary | More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, the protein product of this gene (phakinin), and filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF). Mutations in this gene have been associated with juvenile-onset, progressive cataracts and Dowling-Meara epidermolysis bullosa simplex. [provided by RefSeq, Jun 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418579 | BFSP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418579 | Transient overexpression lysate of beaded filament structural protein 2, phakinin (BFSP2) |
CNY 3080.00 |
|
| TP319996 | Recombinant protein of human beaded filament structural protein 2, phakinin (BFSP2), 20 µg |
CNY 2900.00 |
