TNFRSF18 (NM_004195) Human Mass Spec Standard
CAT#: PH319997
TNFRSF18 MS Standard C13 and N15-labeled recombinant protein (NP_004186)
View other "TNFRSF18" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TNFRSF18 MS Standard C13 and N15-labeled recombinant protein (NP_004186) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219997 |
| Predicted MW | 26 kDa |
| Protein Sequence |
>RC219997 representing NM_004195
Red=Cloning site Green=Tags(s) MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEW DCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFL TVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLLTSAQLGLHIWQLRSQCMWPRETQLLLEVPP STEDARSCQFPEEERGERSAEEKGRLGDLWV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004186 |
| RefSeq Size | 1214 |
| RefSeq ORF | 723 |
| Synonyms | AITR; CD357; ENERGEN; GITR; GITR-D |
| Locus ID | 8784 |
| Cytogenetics | 1p36.33 |
| Summary | This gene encodes a member of the TNF-receptor superfamily. The encoded receptor has been shown to have increased expression upon T-cell activation, and it is thought to play a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. Knockout studies in mice also suggest the role of this receptor is in the regulation of CD3-driven T-cell activation and programmed cell death. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407757 | TNFRSF18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418153 | TNFRSF18 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407757 | Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 18 (TNFRSF18), transcript variant 2 |
CNY 3080.00 |
|
| LY418153 | Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 18 (TNFRSF18), transcript variant 1 |
CNY 3080.00 |
|
| TP319997 | Recombinant protein of human tumor necrosis factor receptor superfamily, member 18 (TNFRSF18), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP723941 | Human GITR Protein, hFc-His tag |
CNY 5249.00 |
|
| TP723942 | Human GITR Protein, mFc-His tag |
CNY 5249.00 |
其它TNFRSF18产品
