Ephrin A4 (EFNA4) (NM_182690) Human Mass Spec Standard
CAT#: PH320109
EFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_872632)
View other "Ephrin A4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | EFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_872632) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220109 |
| Predicted MW | 21.7 kDa |
| Protein Sequence |
>RC220109 representing NM_182690
Red=Cloning site Green=Tags(s) MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGP ETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPES SGQCLRLQVSVCCKERNLPSHPKEPESSQDPLEEEGSLLPALGVPIQTDKMEH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_872632 |
| RefSeq Size | 1111 |
| RefSeq ORF | 579 |
| Synonyms | EFL4; EPLG4; LERK4 |
| Locus ID | 1945 |
| Cytogenetics | 1q21.3 |
| Summary | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
| Protein Pathways | Axon guidance |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405453 | EFNA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417433 | EFNA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405453 | Transient overexpression lysate of ephrin-A4 (EFNA4), transcript variant 3 |
CNY 3080.00 |
|
| LY417433 | Transient overexpression lysate of ephrin-A4 (EFNA4), transcript variant 1 |
CNY 3080.00 |
|
| TP320109 | Recombinant protein of human ephrin-A4 (EFNA4), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Ephrin A4产品
