ULK3 (NM_001099436) Human Mass Spec Standard
CAT#: PH320209
ULK3 MS Standard C13 and N15-labeled recombinant protein (NP_001092906)
View other "ULK3" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ULK3 MS Standard C13 and N15-labeled recombinant protein (NP_001092906) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220209 |
| Predicted MW | 53.3 kDa |
| Protein Sequence |
>RC220209 representing NM_001099436
Red=Cloning site Green=Tags(s) MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLLTEIEILKGIR HPHIVQLKDFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKP QNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWSMGVILYEALFGQ PPFASRSFSELEEKIRSNRVIELPLRPLLSRDCRDLLQRLLERDPSRRISFQDFFAHPWVDLEHMPSGES LGRATALVVQAVKKDQEGDSAAALSLYCKALDFFVPALHYEVDAQRKEAIKAKVGQYVSRAEELKAIVSS SNQALLRQGTSARDLLREMARDKPRLLAALEVASAAMAKEEAAGGEQDALDLYQHSLGELLLLLAAEPPG RRRELLHTEVQNLMARAEYLKEQVKMRESRWEADTLDKEGLSESVRSSCTLQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001092906 |
| RefSeq Size | 2635 |
| RefSeq ORF | 1416 |
| Locus ID | 25989 |
| Cytogenetics | 15q24.1 |
| Summary | Serine/threonine protein kinase that acts as a regulator of Sonic hedgehog (SHH) signaling and autophagy. Acts as a negative regulator of SHH signaling in the absence of SHH ligand: interacts with SUFU, thereby inactivating the protein kinase activity and preventing phosphorylation of GLI proteins (GLI1, GLI2 and/or GLI3). Positively regulates SHH signaling in the presence of SHH: dissociates from SUFU, autophosphorylates and mediates phosphorylation of GLI2, activating it and promoting its nuclear translocation. Phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently. Also acts as a regulator of autophagy: following cellular senescence, able to induce autophagy.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | mTOR signaling pathway, Regulation of autophagy |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420458 | ULK3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY420458 | Transient overexpression lysate of unc-51-like kinase 3 (C. elegans) (ULK3) |
CNY 4840.00 |
|
| TP320209 | Recombinant protein of human unc-51-like kinase 3 (C. elegans) (ULK3), 20 µg |
CNY 2900.00 |
