Tropomyosin 3 (TPM3) (NM_001043353) Human Mass Spec Standard
CAT#: PH320212
TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_001036818)
View other "Tropomyosin 3" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_001036818) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220212 |
| Predicted MW | 28.6 kDa |
| Protein Sequence |
>RC220212 representing NM_001043353
Red=Cloning site Green=Tags(s) MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVEEELDRAQERL ATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDL ERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSV AKLEKTIDDLEERLYSQLERNRLLSNELKLTLHDLCD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001036818 |
| RefSeq Size | 4539 |
| RefSeq ORF | 741 |
| Synonyms | CAPM1; CFTD; HEL-189; HEL-S-82p; hscp30; NEM1; OK/SW-cl.5; TM-5; TM3; TM5; TM30; TM30nm; TPM3nu; TPMsk3; TRK |
| Locus ID | 7170 |
| Cytogenetics | 1q21.3 |
| Summary | This gene encodes a member of the tropomyosin family of actin-binding proteins. Tropomyosins are dimers of coiled-coil proteins that provide stability to actin filaments and regulate access of other actin-binding proteins. Mutations in this gene result in autosomal dominant nemaline myopathy and other muscle disorders. This locus is involved in translocations with other loci, including anaplastic lymphoma receptor tyrosine kinase (ALK) and neurotrophic tyrosine kinase receptor type 1 (NTRK1), which result in the formation of fusion proteins that act as oncogenes. There are numerous pseudogenes for this gene on different chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
| Protein Pathways | Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Thyroid cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407004 | TPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407686 | TPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420816 | TPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420818 | TPM3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407004 | Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 2 |
CNY 3080.00 |
|
| LY407686 | Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 1 |
CNY 3080.00 |
|
| LY420816 | Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 4 |
CNY 3080.00 |
|
| LY420818 | Transient overexpression lysate of tropomyosin 3 (TPM3), transcript variant 5 |
CNY 3080.00 |
|
| PH303276 | TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_689476) |
CNY 19520.00 |
|
| PH309904 | TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_705935) |
CNY 19520.00 |
|
| PH316840 | TPM3 MS Standard C13 and N15-labeled recombinant protein (NP_001036816) |
CNY 19520.00 |
|
| TP303276 | Recombinant protein of human tropomyosin 3 (TPM3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP309904 | Recombinant protein of human tropomyosin 3 (TPM3), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP316840 | Recombinant protein of human tropomyosin 3 (TPM3), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP320212 | Purified recombinant protein of Homo sapiens tropomyosin 3 (TPM3), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP720883 | Purified recombinant protein of Human tropomyosin 3 (TPM3), transcript variant 1 |
CNY 1800.00 |
其它Tropomyosin 3产品
