MRPL30 (NM_145213) Human Mass Spec Standard
CAT#: PH320428
MRPL30 MS Standard C13 and N15-labeled recombinant protein (NP_660214)
View other "MRPL30" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MRPL30 MS Standard C13 and N15-labeled recombinant protein (NP_660214) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220428 |
| Predicted MW | 18.5 kDa |
| Protein Sequence |
>RC220428 protein sequence
Red=Cloning site Green=Tags(s) MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVT RIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLK STGELVVQWHLKPVEQKAHES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_660214 |
| RefSeq Size | 1172 |
| RefSeq ORF | 483 |
| Synonyms | FLJ44438; MGC3314; MGC24095; mitochondrial ribosomal protein L30; MRP-L28; MRPL28; OTTHUMP00000161222; RPML28 |
| Locus ID | 51263 |
| Cytogenetics | 2q11.2 |
| Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. Read-through transcription also exists between this gene and the neighboring upstream lipoyltransferase 1 (LIPT1) gene. [provided by RefSeq, Mar 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403434 | MRPL30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407915 | MRPL30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403434 | Transient overexpression lysate of mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY407915 | Transient overexpression lysate of mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3080.00 |
|
| TP320428 | Recombinant protein of human mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2900.00 |
