Integrin Linked Kinase (ILK) (NM_001014794) Human Mass Spec Standard
CAT#: PH320460
ILK MS Standard C13 and N15-labeled recombinant protein (NP_001014794)
View other "Integrin Linked Kinase" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | ILK MS Standard C13 and N15-labeled recombinant protein (NP_001014794) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220460 |
Predicted MW | 51.4 kDa |
Protein Sequence |
>RC220460 protein sequence
Red=Cloning site Green=Tags(s) MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP LHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA KAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG RWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNV LHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRM YAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001014794 |
RefSeq Size | 1797 |
RefSeq ORF | 1356 |
Synonyms | HEL-S-28; ILK-1; ILK-2; P59; p59ILK |
Locus ID | 3611 |
Cytogenetics | 11p15.4 |
Summary | This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of this protein is important in the epithelial to mesenchymal transition, and over-expression of this gene is implicated in tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Endometrial cancer, Focal adhesion, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401438 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423078 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC423079 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY401438 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 1 |
CNY 3080.00 |
|
LY423078 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 2 |
CNY 4840.00 |
|
LY423079 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 3 |
CNY 4840.00 |
|
TP320460 | Recombinant protein of human integrin-linked kinase (ILK), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP760620 | Purified recombinant protein of Human integrin-linked kinase (ILK), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它Integrin Linked Kinase产品