DPH5 (NM_015958) Human Mass Spec Standard
CAT#: PH320529
DPH5 MS Standard C13 and N15-labeled recombinant protein (NP_057042)
View other "DPH5" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DPH5 MS Standard C13 and N15-labeled recombinant protein (NP_057042) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220529 |
Predicted MW | 31.5 kDa |
Protein Sequence |
>RC220529 representing NM_015958
Red=Cloning site Green=Tags(s) MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLVVADREEVEQEADNILK DADISDVAFLVVGDPFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTW RPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQAAQQLLEIVQNQRIRGEE PAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIITGGSIHPMEMEMLSLFSIPENSSESQ SINGL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057042 |
RefSeq Size | 1457 |
RefSeq ORF | 855 |
Synonyms | AD-018; CGI-30; HSPC143; NPD015 |
Locus ID | 51611 |
Cytogenetics | 1p21.2 |
Summary | This gene encodes a component of the diphthamide synthesis pathway. Diphthamide is a post-translationally modified histidine residue found only on translation elongation factor 2. It is conserved from archaebacteria to humans, and is targeted by diphtheria toxin and Pseudomonas exotoxin A to halt cellular protein synthesis. The yeast and Chinese hamster homologs of this protein catalyze the trimethylation of the histidine residue on elongation factor 2, resulting in a diphthine moiety that is subsequently amidated to yield diphthamide. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414310 | DPH5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421406 | DPH5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414310 | Transient overexpression lysate of DPH5 homolog (S. cerevisiae) (DPH5), transcript variant 2 |
CNY 3080.00 |
|
LY421406 | Transient overexpression lysate of DPH5 homolog (S. cerevisiae) (DPH5), transcript variant 3 |
CNY 3080.00 |
|
TP320529 | Recombinant protein of human DPH5 homolog (S. cerevisiae) (DPH5), transcript variant 2, 20 µg |
CNY 2900.00 |