Osteocalcin (BGLAP) (NM_199173) Human Mass Spec Standard
CAT#: PH320555
BGLAP MS Standard C13 and N15-labeled recombinant protein (NP_954642)
View other "Osteocalcin" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BGLAP MS Standard C13 and N15-labeled recombinant protein (NP_954642) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220555 |
| Predicted MW | 8.7 kDa |
| Protein Sequence |
>RC220555 representing NM_199173
Red=Cloning site Green=Tags(s) MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR REVCELNPDCDELADHIGFQEAYRRFYGPV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_954642 |
| RefSeq Size | 498 |
| RefSeq ORF | 300 |
| Synonyms | BGP; OC; OCN |
| Locus ID | 632 |
| Cytogenetics | 1q22 |
| Summary | This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product. [provided by RefSeq, Jun 2015] |
| Protein Families | ES Cell Differentiation/IPS, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404673 | BGLAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404673 | Transient overexpression lysate of bone gamma-carboxyglutamate (gla) protein (BGLAP) |
CNY 3080.00 |
|
| TP320555 | Recombinant protein of human bone gamma-carboxyglutamate (gla) protein (BGLAP), 20 µg |
CNY 2900.00 |
|
| TP701039 | Purified recombinant protein of Human bone gamma-carboxyglutamate (gla) protein (BGLAP), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
其它Osteocalcin产品
