MEF2C (NM_002397) Human Mass Spec Standard
CAT#: PH320584
MEF2C MS Standard C13 and N15-labeled recombinant protein (NP_002388)
View other "MEF2C" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | MEF2C MS Standard C13 and N15-labeled recombinant protein (NP_002388) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220584 |
Predicted MW | 51 kDa |
Protein Sequence |
>RC220584 representing NM_002397
Red=Cloning site Green=Tags(s) MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYT EYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPN FEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGT SAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQ RINNSQSAQSLATPVVSVATPTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGW QQQHLHNMPPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002388 |
RefSeq Size | 4077 |
RefSeq ORF | 1419 |
Synonyms | C5DELq14.3; DEL5q14.3 |
Locus ID | 4208 |
Cytogenetics | 5q14.3 |
Summary | This locus encodes a member of the MADS box transcription enhancer factor 2 (MEF2) family of proteins, which play a role in myogenesis. The encoded protein, MEF2 polypeptide C, has both trans-activating and DNA binding activities. This protein may play a role in maintaining the differentiated state of muscle cells. Mutations and deletions at this locus have been associated with severe cognitive disability, stereotypic movements, epilepsy, and cerebral malformation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2010] |
Protein Families | Transcription Factors |
Protein Pathways | MAPK signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419349 | MEF2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC434220 | MEF2C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419349 | Transient overexpression lysate of myocyte enhancer factor 2C (MEF2C), transcript variant 1 |
CNY 3080.00 |
|
LY434220 | Transient overexpression lysate of myocyte enhancer factor 2C (MEF2C), transcript variant 4 |
CNY 3080.00 |
|
TP320584 | Recombinant protein of human myocyte enhancer factor 2C (MEF2C), transcript variant 1, 20 µg |
CNY 2900.00 |