GM CSF Receptor alpha (CSF2RA) (NM_172247) Human Mass Spec Standard
CAT#: PH320607
CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758450)
View other "GM CSF Receptor alpha" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758450) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220607 |
| Predicted MW | 36.3 kDa |
| Protein Sequence |
>RC220607 representing NM_172247
Red=Cloning site Green=Tags(s) MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVV EPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWAR GPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLL DTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENR YNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSLGYSGCSRQFHRSKTN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_758450 |
| RefSeq Size | 1587 |
| RefSeq ORF | 999 |
| Synonyms | alphaGMR; CD116; CDw116; CSF2R; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM-CSF-R-alpha; GMCSFR; GMCSFR-alpha; GMR; GMR-alpha; SMDP4 |
| Locus ID | 1438 |
| Cytogenetics | X;Y |
| Summary | The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway, Pathways in cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403538 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406763 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416841 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431354 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431905 | CSF2RA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403538 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 4 |
CNY 3080.00 |
|
| LY406763 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2 |
CNY 3080.00 |
|
| LY416841 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 1 |
CNY 3080.00 |
|
| LY431354 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 9 |
CNY 3080.00 |
|
| LY431905 | Transient overexpression lysate of colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 7 |
CNY 3080.00 |
|
| PH301204 | CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758448) |
CNY 19520.00 |
|
| PH315857 | CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_006131) |
CNY 19520.00 |
|
| TP301204 | Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP315857 | Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP320607 | Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 4, 20 µg |
CNY 2900.00 |
|
| TP328877 | Recombinant protein of human colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) (CSF2RA), transcript variant 7, 20 µg |
CNY 2900.00 |
其它GM CSF Receptor alpha产品
