NFE4 (NM_001085386) Human Mass Spec Standard
CAT#: PH320641
NFE4 MS Standard C13 and N15-labeled recombinant protein (NP_001078855)
View other "NFE4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | NFE4 MS Standard C13 and N15-labeled recombinant protein (NP_001078855) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220641 |
| Predicted MW | 20.33 kDa |
| Protein Sequence |
>RC220641 representing NM_001085386
Red=Cloning site Green=Tags(s) LDPVPRRSAAAIALPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQ LLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPRGHAPSAEDPTG SWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001078855 |
| RefSeq Size | 967 |
| RefSeq ORF | 576 |
| Synonyms | NF-E4 |
| Locus ID | 58160 |
| Cytogenetics | 7q22.1 |
| Summary | The erythroid-specific protein encoded by this gene, and the ubiquitous transcription factor CP2, form the stage selector protein (SSP) complex, which is involved in preferential expression of the gamma-globin genes in fetal erythroid cells. Alternate use of an in-frame upstream non-AUG (CUG) translation initiation codon, and a downstream AUG codon, results in two isoforms. While the long isoform (22 kDa) acts as an activator, the short isoform (14 kDa) has been shown to repress gamma-globin gene expression. This gene is located in an intron of the FBXL13 gene on the opposite strand. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421283 | NFE4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421283 | Transient overexpression lysate of transcription factor NF-E4 (NF-E4) |
CNY 3080.00 |
|
| TP320641 | Recombinant protein of human transcription factor NF-E4 (NF-E4), 20 µg |
CNY 2900.00 |
