POLR2J2 (POLR2J3) (NM_001097615) Human Mass Spec Standard

Specifications

Product Data
Description	POLR2J3 MS Standard C13 and N15-labeled recombinant protein (NP_001091084)
Species	Human
Expression Host	HEK293
Expression cDNA Clone or AA Sequence	RC220730
Predicted MW	12.9 kDa
Protein Sequence	Sequence Link (showhide) >RC220730 representing NM_001097615 Red=Cloning site Green=Tags(s) MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP myc-FLAG tag
Tag	C-Myc/DDK
Purity	> 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration	>0.05 µg/µL as determined by microplate BCA method
Labeling Method	Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer	25 mM Tris-HCl, 100 mM glycine, pH 7.3
Reference Data
RefSeq	NP_001091084
RefSeq Size	1680
RefSeq ORF	345
Synonyms	POLR2J2; RPB11b1; RPB11b2
Locus ID	548644
Cytogenetics	7q22.1
Summary	This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008]
Protein Pathways	Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.