SOCS1 (NM_003745) Human Mass Spec Standard
CAT#: PH320847
SOCS1 MS Standard C13 and N15-labeled recombinant protein (NP_003736)
View other "SOCS1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | SOCS1 MS Standard C13 and N15-labeled recombinant protein (NP_003736) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC220847 | 
| Predicted MW | 23.4 kDa | 
| Protein Sequence | 
                 >RC220847 representing NM_003745 
Red=Cloning site Green=Tags(s) MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA SALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGS RESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQ I myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_003736 | 
| RefSeq Size | 1216 | 
| RefSeq ORF | 633 | 
| Synonyms | AISIMD; CIS1; CISH1; JAB; SOCS-1; SSI-1; SSI1; TIP-3; TIP3 | 
| Locus ID | 8651 | 
| Cytogenetics | 16p13.13 | 
| Summary | This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including IL2, IL3 erythropoietin (EPO), CSF2/GM-CSF, and interferon (IFN)-gamma. The protein encoded by this gene functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of this gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway | 
| Protein Pathways | Insulin signaling pathway, Jak-STAT signaling pathway, Type II diabetes mellitus, Ubiquitin mediated proteolysis | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401230 | SOCS1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401230 | Transient overexpression lysate of suppressor of cytokine signaling 1 (SOCS1) | 
                                                     CNY 3080.00  | 
                                            |
| TP320847 | Recombinant protein of human suppressor of cytokine signaling 1 (SOCS1), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
