ALDH4A1 (NM_003748) Human Mass Spec Standard
CAT#: PH320893
ALDH4A1 MS Standard C13 and N15-labeled recombinant protein (NP_003739)
View other "ALDH4A1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | ALDH4A1 MS Standard C13 and N15-labeled recombinant protein (NP_003739) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220893 |
Predicted MW | 61.7 kDa |
Protein Sequence |
>RC220893 protein sequence
Red=Cloning site Green=Tags(s) MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGD EEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRR AEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPF NFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLC GINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSA CSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGK CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVV QEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYA YMQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003739 |
RefSeq Size | 3399 |
RefSeq ORF | 1689 |
Synonyms | ALDH4; P5CD; P5CDh |
Locus ID | 8659 |
Cytogenetics | 1p36.13 |
Summary | This protein belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406901 | ALDH4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418458 | ALDH4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406901 | Transient overexpression lysate of aldehyde dehydrogenase 4 family, member A1 (ALDH4A1), nuclear gene encoding mitochondrial protein, transcript variant P5CDhS |
CNY 3080.00 |
|
LY418458 | Transient overexpression lysate of aldehyde dehydrogenase 4 family, member A1 (ALDH4A1), nuclear gene encoding mitochondrial protein, transcript variant P5CDhL |
CNY 3080.00 |
|
PH304884 | ALDH4A1 MS Standard C13 and N15-labeled recombinant protein (NP_733844) |
CNY 19520.00 |
|
TP304884 | Recombinant protein of human aldehyde dehydrogenase 4 family, member A1 (ALDH4A1), nuclear gene encoding mitochondrial protein, transcript variant P5CDhS, 20 µg |
CNY 2900.00 |
|
TP320893 | Recombinant protein of human aldehyde dehydrogenase 4 family, member A1 (ALDH4A1), nuclear gene encoding mitochondrial protein, transcript variant P5CDhL, 20 µg |
CNY 2900.00 |
其它ALDH4A1产品