NRP2 (NM_201266) Human Mass Spec Standard
CAT#: PH320920
NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957718)
View other "NRP2" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957718) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220920 |
Predicted MW | 102.3 kDa |
Protein Sequence |
>RC220920 representing NM_201266
Red=Cloning site Green=Tags(s) MTFYSPAVMNYSVPGSTSNLDGGPVRLSTSPNVLWPTSGHLSPLATHCQSSLLYAEPQKSPWCEARSLEH TLPVNRETLKRKLSGSSCASPVTSPNAKRDAHFCPVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYIC PATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRIVRRQRSSSEQVHCLSKAKRNGGHAPRV KELLLSTLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLL DQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHK EYLCVKAMILLNSSMYPLASANQEAESSRKLTHLLNAVTDALVWVIAKSGISSQQQSVRLANLLMLLSHV RHISNKGMEHLLSMKCKNVVPVYDLLLEMLNAHTLRGYKSSISGSECSSTEDSKNKESSQNLQSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_957718 |
RefSeq Size | 6671 |
RefSeq ORF | 2793 |
Synonyms | NP2; NPN2; PRO2714; VEGF165R2 |
Locus ID | 8828 |
Cytogenetics | 2q33.3 |
Summary | This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Promotion of metastasis of thyroid cancer cells via NRP-2-mediated induction
,null,
Oncology Letters
,PubMed ID 27895796
[NRP2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401275 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC403706 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC404506 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430844 | NRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401275 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 2 |
CNY 4840.00 |
|
LY403706 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 1 |
CNY 4840.00 |
|
LY404506 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 5 |
CNY 3080.00 |
|
LY430844 | Transient overexpression lysate of neuropilin 2 (NRP2), transcript variant 6 |
CNY 3080.00 |
|
PH310928 | NRP2 MS Standard C13 and N15-labeled recombinant protein (NP_957719) |
CNY 19520.00 |
|
TP310928 | Recombinant protein of human neuropilin 2 (NRP2), transcript variant 5, 20 µg |
CNY 2900.00 |
|
TP320920 | Recombinant protein of human neuropilin 2 (NRP2), transcript variant 1, 20 µg |
CNY 2900.00 |