APOBEC3A (NM_145699) Human Mass Spec Standard
CAT#: PH320995
APOBEC3A MS Standard C13 and N15-labeled recombinant protein (NP_663745)
View other "APOBEC3A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | APOBEC3A MS Standard C13 and N15-labeled recombinant protein (NP_663745) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220995 |
Predicted MW | 22.8 kDa |
Protein Sequence |
>RC220995 representing NM_145699
Red=Cloning site Green=Tags(s) MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYGRH AELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEAL QMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_663745 |
RefSeq Size | 1349 |
RefSeq ORF | 597 |
Synonyms | A3A; ARP3; bK150C2.1; PHRBN |
Locus ID | 200315 |
Cytogenetics | 22q13.1 |
Summary | This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene lacks the zinc binding activity of other family members. The protein plays a role in immunity, by restricting transmission of foreign DNA such as viruses. One mechanism of foreign DNA restriction is deamination of foreign double-stranded DNA cytidines to uridines, which leads to DNA degradation. However, other mechanisms are also thought to be involved, as anti-viral effect is not dependent on deaminase activity. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407901 | APOBEC3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407901 | Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A (APOBEC3A) |
CNY 3080.00 |
|
TP320995 | Purified recombinant protein of Homo sapiens apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3A (APOBEC3A), 20 µg |
CNY 2900.00 |
其它APOBEC3A产品