DEFB108B (NM_001002035) Human Mass Spec Standard
CAT#: PH321032
DEFB108B MS Standard C13 and N15-labeled recombinant protein (NP_001002035)
View other "DEFB108B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DEFB108B MS Standard C13 and N15-labeled recombinant protein (NP_001002035) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221032 |
Predicted MW | 8.1 kDa |
Protein Sequence |
>RC221032 representing NM_001002035
Red=Cloning site Green=Tags(s) MRIAVLLFAIFFFMSQVLPARGKFKEICERPNGSCRDFCLETEIHVGRCLNSQPCCLPLGHQPRIESTTP KKD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001002035 |
RefSeq Size | 222 |
RefSeq ORF | 219 |
Synonyms | DEFB-8; hBD-8 |
Locus ID | 245911 |
Cytogenetics | 11q13.4 |
Summary | Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. A pseudogene of this gene has been found on chromosome 8. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424174 | DEFB108B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424174 | Transient overexpression lysate of defensin, beta 108B (DEFB108B) |
CNY 3080.00 |
|
TP321032 | Recombinant protein of human defensin, beta 108B (DEFB108B), 20 µg |
CNY 2900.00 |
其它DEFB108B产品