PDE4C (NM_001098819) Human Mass Spec Standard
CAT#: PH321103
PDE4C MS Standard C13 and N15-labeled recombinant protein (NP_001092289)
View other "PDE4C" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 6281.00
CNY 4840.00
Specifications
| Product Data | |
| Description | PDE4C MS Standard C13 and N15-labeled recombinant protein (NP_001092289) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221103 |
| Predicted MW | 67.6 kDa |
| Protein Sequence |
>RC221103 representing NM_001098819
Red=Cloning site Green=Tags(s) MQAPVPHSQRRESFLYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQ CLGAAKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRILNRELT HLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSASLSSATVPRFGVQTDQ EEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLLKTFQIPADTLATYLLMLEGHYHANVA YHNSLHAADVAQSTHVLLATPALEAVFTDLEILAALFASAIHDVDHPGVSNQFLINTNSELALMYNDASV LENHHLAVGFKLLQAENCDIFQNLSAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVL LLDNYSDRIQVLQNLVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKS QVGFIDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFELTLEEAE EEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001092289 |
| RefSeq Size | 5124 |
| RefSeq ORF | 1818 |
| Synonyms | DPDE1; PDE21 |
| Locus ID | 5143 |
| Cytogenetics | 19p13.11 |
| Summary | The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE4 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular signals. Thus, by regulating the cellular concentration of cAMP, this protein plays a key role in many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420350 | PDE4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420351 | PDE4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426049 | PDE4C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420350 | Transient overexpression lysate of phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) (PDE4C), transcript variant 3 |
CNY 4840.00 |
|
| LY420351 | Transient overexpression lysate of phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) (PDE4C), transcript variant 2 |
CNY 4840.00 |
|
| TP321103 | Recombinant protein of human phosphodiesterase 4C, cAMP-specific (phosphodiesterase E1 dunce homolog, Drosophila) (PDE4C), transcript variant 2, 20 µg |
CNY 2900.00 |
