ZFAND5 (NM_001102421) Human Mass Spec Standard
CAT#: PH321129
ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095891)
View other "ZFAND5" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095891) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221129 |
| Predicted MW | 23.1 kDa |
| Protein Sequence |
>RC221129 protein sequence
Red=Cloning site Green=Tags(s) MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRAD TSLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSE EKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKI QRI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001095891 |
| RefSeq Size | 5750 |
| RefSeq ORF | 639 |
| Synonyms | ZA20D2; ZFAND5A; ZNF216 |
| Locus ID | 7763 |
| Cytogenetics | 9q21.13 |
| Summary | Involved in protein degradation via the ubiquitin-proteasome system. May act by anchoring ubiquitinated proteins to the proteasome. Plays a role in ubiquitin-mediated protein degradation during muscle atrophy. Plays a role in the regulation of NF-kappa-B activation and apoptosis. Inhibits NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. Inhibits also tumor necrosis factor (TNF), IL-1 and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Overexpression sensitizes cells to TNF-induced apoptosis. Is a potent inhibitory factor for osteoclast differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416931 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420147 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420148 | ZFAND5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416931 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c |
CNY 3080.00 |
|
| LY420147 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a |
CNY 3080.00 |
|
| LY420148 | Transient overexpression lysate of zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b |
CNY 3080.00 |
|
| PH309943 | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_005998) |
CNY 19520.00 |
|
| PH321072 | ZFAND5 MS Standard C13 and N15-labeled recombinant protein (NP_001095890) |
CNY 19520.00 |
|
| TP309943 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, 20 µg |
CNY 2900.00 |
|
| TP321072 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant a, 20 µg |
CNY 2900.00 |
|
| TP321129 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant b, 20 µg |
CNY 2900.00 |
|
| TP710147 | Recombinant protein of human zinc finger, AN1-type domain 5 (ZFAND5), transcript variant c, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
