LAMP2 (NM_002294) Human Mass Spec Standard
CAT#: PH321216
LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002285)
View other "LAMP2" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002285) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221216 |
Predicted MW | 44.96 kDa |
Protein Sequence |
>RC221216 representing NM_002294
Red=Cloning site Green=Tags(s) MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHG TVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDEL LAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTT TPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIK YLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDL RVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002285 |
RefSeq Size | 1868 |
RefSeq ORF | 1230 |
Synonyms | CD107b; DND; LAMP-2; LAMPB; LGP-96; LGP110 |
Locus ID | 3920 |
Cytogenetics | Xq24 |
Summary | The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Lysosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419414 | LAMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419414 | Transient overexpression lysate of lysosomal-associated membrane protein 2 (LAMP2), transcript variant A |
CNY 3080.00 |
|
PH300456 | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_054701) |
CNY 19520.00 |
|
PH325644 | LAMP2 MS Standard C13 and N15-labeled recombinant protein (NP_001116078) |
CNY 14250.00 |
|
TP300456 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant B, 20 µg |
CNY 2900.00 |
|
TP321216 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant A, 20 µg |
CNY 2900.00 |
|
TP325644 | Purified recombinant protein of Homo sapiens lysosomal-associated membrane protein 2 (LAMP2), transcript variant C, 20 µg |
CNY 2900.00 |
|
TP720402 | Recombinant protein of human lysosomal-associated membrane protein 2 (LAMP2), transcript variant C |
CNY 1800.00 |