MAP2 (NM_031845) Human Mass Spec Standard
CAT#: PH321637
MAP2 MS Standard C13 and N15-labeled recombinant protein (NP_114033)
View other "MAP2" proteins (11)
| Need it in bulk or customized? Get a free quote | 
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 3600.00
                                                
                                            
CNY 4840.00
Specifications
| Product Data | |
| Description | MAP2 MS Standard C13 and N15-labeled recombinant protein (NP_114033) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC221637 | 
| Predicted MW | 49.5 kDa | 
| Protein Sequence | >RC221637 representing NM_031845 Red=Cloning site Green=Tags(s) MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNT KENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAEETANLPPSPPPSP ASEQTVTVEEAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNS SISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAIL VPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSK CGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAE IITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_114033 | 
| RefSeq Size | 2466 | 
| RefSeq ORF | 1410 | 
| Synonyms | MAP-2; MAP2A; MAP2B; MAP2C | 
| Locus ID | 4133 | 
| Cytogenetics | 2q34 | 
| Summary | This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2010] | 
| Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC410495 | MAP2 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 1470.00 | |
| LC410496 | MAP2 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 1470.00 | |
| LC419369 | MAP2 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 1470.00 | |
| LC422067 | MAP2 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 1470.00 | |
| LY410495 | Transient overexpression lysate of microtubule-associated protein 2 (MAP2), transcript variant 2 | CNY 4840.00 | |
| LY410496 | Transient overexpression lysate of microtubule-associated protein 2 (MAP2), transcript variant 4 | CNY 4840.00 | |
| LY419369 | Transient overexpression lysate of microtubule-associated protein 2 (MAP2), transcript variant 1 | CNY 4840.00 | |
| LY422067 | Transient overexpression lysate of microtubule-associated protein 2 (MAP2), transcript variant 5 | CNY 4840.00 | |
| PH316775 | MAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002365) | CNY 19520.00 | |
| TP316775 | Recombinant protein of human microtubule-associated protein 2 (MAP2), transcript variant 1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP321637 | Recombinant protein of human microtubule-associated protein 2 (MAP2), transcript variant 2, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        


 
        