SNX5 (NM_152227) Human Mass Spec Standard
CAT＃: PH321829
SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_689413)
View other "SNX5" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_689413) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221829 |
| Predicted MW | 46.8 kDa |
| Protein Sequence |
>RC221829 protein sequence
Red=Cloning site Green=Tags(s) MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHE DFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTV SSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFE QEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVE GRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKF EQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689413 |
| RefSeq Size | 2308 |
| RefSeq ORF | 1212 |
| Locus ID | 27131 |
| Cytogenetics | 20p11.23 |
| Summary | This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoinositide-signaling pathway, and macropinocytosis. This gene may play a role in the tumorigenesis of papillary thyroid carcinoma. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402334 | SNX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407705 | SNX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402334 | Transient overexpression lysate of sorting nexin 5 (SNX5), transcript variant 2 |
CNY 3080.00 |
|
| LY407705 | Transient overexpression lysate of sorting nexin 5 (SNX5), transcript variant 1 |
CNY 3080.00 |
|
| PH310773 | SNX5 MS Standard C13 and N15-labeled recombinant protein (NP_055241) |
CNY 19520.00 |
|
| TP310773 | Recombinant protein of human sorting nexin 5 (SNX5), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP321829 | Recombinant protein of human sorting nexin 5 (SNX5), transcript variant 1, 20 µg |
CNY 2900.00 |
