IL1 Receptor II (IL1R2) (NM_004633) Human Mass Spec Standard
CAT#: PH321860
IL1R2 MS Standard C13 and N15-labeled recombinant protein (NP_004624)
View other "IL1 Receptor II" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | IL1R2 MS Standard C13 and N15-labeled recombinant protein (NP_004624) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221860 |
| Predicted MW | 45.42 kDa |
| Protein Sequence |
>RC221860 representing NM_004633
Red=Cloning site Green=Tags(s) MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWH KNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQ ILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLT FAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTH IESAYPGGRVTEGPRQEYSENNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSW GIVLAPLSLAFLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004624 |
| RefSeq Size | 1484 |
| RefSeq ORF | 1194 |
| Synonyms | CD121b; CDw121b; IL-1R-2; IL-1RT-2; IL-1RT2; IL1R2c; IL1RB |
| Locus ID | 7850 |
| Cytogenetics | 2q11.2 |
| Summary | The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. Interleukin 4 (IL4) is reported to antagonize the activity of interleukin 1 by inducing the expression and release of this cytokine. This gene and three other genes form a cytokine receptor gene cluster on chromosome 2q12. Alternative splicing results in multiple transcript variants and protein isoforms. Alternative splicing produces both membrane-bound and soluble proteins. A soluble protein is also produced by proteolytic cleavage. [provided by RefSeq, May 2012] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, MAPK signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401469 | IL1R2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406630 | IL1R2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401469 | Transient overexpression lysate of interleukin 1 receptor, type II (IL1R2), transcript variant 1 |
CNY 3080.00 |
|
| LY406630 | Transient overexpression lysate of interleukin 1 receptor, type II (IL1R2), transcript variant 2 |
CNY 3080.00 |
|
| PH307914 | IL1R2 MS Standard C13 and N15-labeled recombinant protein (NP_775465) |
CNY 19520.00 |
|
| TP307914 | Recombinant protein of human interleukin 1 receptor, type II (IL1R2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP321860 | Recombinant protein of human interleukin 1 receptor, type II (IL1R2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它IL1 Receptor II产品
