CK1 epsilon (CSNK1E) (NM_001894) Human Mass Spec Standard
CAT＃: PH321884
CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_001885)
View other "CK1 epsilon" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
热销推荐CNY 3080.00
Specifications
| Product Data | |
| Description | CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_001885) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221884 |
| Predicted MW | 47.3 kDa |
| Protein Sequence |
>RC221884 protein sequence
Red=Cloning site Green=Tags(s) MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLHIESKFYKMMQGGVGIPSIKW CGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGK KGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGS LPWQGLKAATKRQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVAS TPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001885 |
| RefSeq Size | 2670 |
| RefSeq ORF | 1248 |
| Synonyms | CKIe; CKIepsilon; HCKIE |
| Locus ID | 1454 |
| Cytogenetics | 22q13.1 |
| Summary | The protein encoded by this gene is a serine/threonine protein kinase and a member of the casein kinase I protein family, whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is found in the cytoplasm as a monomer and can phosphorylate a variety of proteins, including itself. This protein has been shown to phosphorylate period, a circadian rhythm protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Feb 2014] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Circadian rhythm - mammal, Hedgehog signaling pathway, Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403455 | CSNK1E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419672 | CSNK1E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403455 | Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 1 |
CNY 3080.00 |
|
| LY419672 | Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 2 |
CNY 3080.00 |
|
| PH302436 | CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_689407) |
CNY 19520.00 |
|
| TP302436 | Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP321884 | Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 2, 20 µg |
CNY 2900.00 |
其它CK1 epsilon产品
