ARL13B (NM_182896) Human Mass Spec Standard
CAT#: PH321949
ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_878899)
View other "ARL13B" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_878899) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221949 |
Predicted MW | 48.5 kDa |
Protein Sequence |
>RC221949 representing NM_182896
Red=Cloning site Green=Tags(s) MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIF DLGGGIRIRGIWKNYYAESYGVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVLANKQDKEGALGE ADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDKSIKKGLYWLLHVIARDFDALNERIQKETTEQRA LEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLAELDPEPTNPFQPIASVIIENEGKLEREKKNQKM EKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLVENYKEALTQQLKNEDETDRPSLESANGKKKTKK LRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPN SDAHDVIS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_878899 |
RefSeq Size | 3451 |
RefSeq ORF | 1284 |
Synonyms | ARL2L1; JBTS8 |
Locus ID | 200894 |
Cytogenetics | 3q11.1-q11.2 |
Summary | This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405389 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC408134 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432892 | ARL13B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405389 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1 |
CNY 4840.00 |
|
LY408134 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2 |
CNY 3080.00 |
|
LY432892 | Transient overexpression lysate of ADP-ribosylation factor-like 13B (ARL13B), transcript variant 4 |
CNY 3080.00 |
|
PH310490 | ARL13B MS Standard C13 and N15-labeled recombinant protein (NP_659433) |
CNY 19520.00 |
|
TP310490 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP321949 | Recombinant protein of human ADP-ribosylation factor-like 13B (ARL13B), transcript variant 1, 20 µg |
CNY 2900.00 |