LCE3A (NM_178431) Human Mass Spec Standard
CAT#: PH322176
LCE3A MS Standard C13 and N15-labeled recombinant protein (NP_848518)
View other "LCE3A" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LCE3A MS Standard C13 and N15-labeled recombinant protein (NP_848518) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222176 |
| Predicted MW | 9 kDa |
| Protein Sequence |
>RC222176 representing NM_178431
Red=Cloning site Green=Tags(s) MSCQQNQQQCQPPPKCPAKSPAQCLPPASSSCAPSSGGCGPSSERSCCLSHHRCRRSHRCRCQSSNSCDR GSGQQGGSSSCGHSSAGCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_848518 |
| RefSeq Size | 270 |
| RefSeq ORF | 267 |
| Synonyms | LEP13 |
| Locus ID | 353142 |
| Cytogenetics | 1q21.3 |
| Summary | A structural component of the cornified envelope of the stratum corneum involved in innate cutaneous host defense (Probable). Possesses defensin-like antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria, both aerobic and anaerobic species. Upon inflammation, may regulate skin barrier repair by shaping cutaneous microbiota composition and immune response to bacterial antigens (PubMed:28634035).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405955 | LCE3A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405955 | Transient overexpression lysate of late cornified envelope 3A (LCE3A) |
CNY 3080.00 |
|
| TP322176 | Recombinant protein of human late cornified envelope 3A (LCE3A), 20 µg |
CNY 2900.00 |
