Calpastatin (CAST) (NM_173061) Human Mass Spec Standard
CAT#: PH322278
CAST MS Standard C13 and N15-labeled recombinant protein (NP_775084)
View other "Calpastatin" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
| Cited in 1 publication. |
Specifications
| Product Data | |
| Description | CAST MS Standard C13 and N15-labeled recombinant protein (NP_775084) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222278 |
| Predicted MW | 46.9 kDa |
| Protein Sequence |
>RC222278 representing NM_173061
Red=Cloning site Green=Tags(s) MGQFLSSTFLEGSPATVWHDKLCDGERRGAREAVRIFQDQAKAKEEKLEKCGEDDETIPSEYRLKPATDK DGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQS APPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVK DKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPP RDTSSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQD KPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKT TEETSKPKDD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_775084 |
| RefSeq Size | 1889 |
| RefSeq ORF | 1290 |
| Synonyms | BS-17; calpain inhibitor; calpastatin; heart-type calpastatin; MGC9402; OTTHUMP00000158519; OTTHUMP00000158520; sperm BS-17 component |
| Locus ID | 831 |
| Cytogenetics | 5q15 |
| Summary | The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Decreased calpain activity in chronic myeloid leukemia impairs apoptosis by increasing survivin in myeloid progenitors and xiap1 in differentiating granulocytes
,null,
Oncotarget
,PubMed ID 28881589
[Calpastatin]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400663 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406666 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420908 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434378 | CAST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400663 | Transient overexpression lysate of calpastatin (CAST), transcript variant 1 |
CNY 4840.00 |
|
| LY406666 | Transient overexpression lysate of calpastatin (CAST), transcript variant 2 |
CNY 4840.00 |
|
| LY420908 | Transient overexpression lysate of calpastatin (CAST), transcript variant 10 |
CNY 3080.00 |
|
| LY434378 | Transient overexpression lysate of calpastatin (CAST), transcript variant 11 |
CNY 4840.00 |
|
| PH302168 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001035909) |
CNY 19520.00 |
|
| PH311776 | CAST MS Standard C13 and N15-labeled recombinant protein (NP_001741) |
CNY 19520.00 |
|
| TP302168 | Recombinant protein of human calpastatin (CAST), transcript variant 10, 20 µg |
CNY 2900.00 |
|
| TP311776 | Recombinant protein of human calpastatin (CAST), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP322278 | Purified recombinant protein of Homo sapiens calpastatin (CAST), transcript variant 3, 20 µg |
CNY 2900.00 |
其它Calpastatin产品


