PDX1 (NM_000209) Human Mass Spec Standard
CAT#: PH322354
PDX1 MS Standard C13 and N15-labeled recombinant protein (NP_000200)
View other "PDX1" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PDX1 MS Standard C13 and N15-labeled recombinant protein (NP_000200) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222354 |
| Predicted MW | 30.6 kDa |
| Protein Sequence |
>RC222354 representing NM_000209
Red=Cloning site Green=Tags(s) MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPYEV PPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYA AEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRG GGTAVGGGGVAEPEQDCAVTSGEELLALPPPPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ EPR SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_000200 |
| RefSeq Size | 1525 |
| RefSeq ORF | 849 |
| Synonyms | GSF; IDX-1; IPF1; IUF1; MODY4; PAGEN1; PDX-1; STF-1 |
| Locus ID | 3651 |
| Cytogenetics | 13q12.2 |
| Summary | The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (IDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Aug 2017] |
| Protein Families | Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
| Protein Pathways | Maturity onset diabetes of the young, Type II diabetes mellitus |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400074 | PDX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400074 | Transient overexpression lysate of pancreatic and duodenal homeobox 1 (PDX1) |
CNY 3080.00 |
|
| TP322354 | Recombinant protein of human pancreatic and duodenal homeobox 1 (PDX1), 20 µg |
CNY 2900.00 |
|
| TP760660 | Purified recombinant protein of Human pancreatic and duodenal homeobox 1 (PDX1), with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
