CSNK1G3 (NM_004384) Human Mass Spec Standard
CAT#: PH322490
CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_004375)
View other "CSNK1G3" proteins (13)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_004375) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222490 |
Predicted MW | 47.92 kDa |
Protein Sequence |
>RC222490 representing NM_004384
Red=Cloning site Green=Tags(s) MENKKKDKDKSDDRMARPSGRSGHNTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNEYVA IKLEPMKSRAPQLHLEYRFYKQLGSGDGIPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVL MIAIQLISRMEYVHSKNLIYRDVKPENFLIGRPGNKTQQVIHIIDFALAKEYIDPETKKHIPYREHKSLT GTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENF PEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGYMFDYEYDWIGKQLPTPVGAVQQDPALSSNREAH QHRDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITAPTEVEVMDETKCCCFFKRRKRKTIQRHK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004375 |
RefSeq Size | 4352 |
RefSeq ORF | 1245 |
Synonyms | CKI-gamma 3; CSNK1G3L |
Locus ID | 1456 |
Cytogenetics | 5q23.2 |
Summary | This gene encodes a member of a family of serine/threonine protein kinases that phosphorylate caseins and other acidic proteins. A related protein in the African clawed frog participates in the transmission of Wnt/beta-catenin signaling. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Hedgehog signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401396 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC420831 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420832 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC422199 | CSNK1G3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401396 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1 |
CNY 4840.00 |
|
LY420831 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 3 |
CNY 3080.00 |
|
LY420832 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4 |
CNY 4840.00 |
|
LY422199 | Transient overexpression lysate of casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2 |
CNY 3080.00 |
|
PH307965 | CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001026982) |
CNY 19520.00 |
|
PH322230 | CSNK1G3 MS Standard C13 and N15-labeled recombinant protein (NP_001038188) |
CNY 14250.00 |
|
TP307965 | Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP322230 | Purified recombinant protein of Homo sapiens casein kinase 1, gamma 3 (CSNK1G3), transcript variant 4, 20 µg |
CNY 2900.00 |
|
TP322490 | Recombinant protein of human casein kinase 1, gamma 3 (CSNK1G3), transcript variant 1, 20 µg |
CNY 2900.00 |
其它CSNK1G3产品