DAP12 (TYROBP) (NM_003332) Human Mass Spec Standard
CAT#: PH322502
TYROBP MS Standard C13 and N15-labeled recombinant protein (NP_003323)
View other "DAP12" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TYROBP MS Standard C13 and N15-labeled recombinant protein (NP_003323) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222502 |
| Predicted MW | 12.2 kDa |
| Protein Sequence |
>RC222502 protein sequence
Red=Cloning site Green=Tags(s) MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPR GRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003323 |
| RefSeq Size | 608 |
| RefSeq ORF | 339 |
| Synonyms | DAP12; KARAP; PLOSL; PLOSL1 |
| Locus ID | 7305 |
| Cytogenetics | 19q13.12 |
| Summary | This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Mar 2010] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403671 | TYROBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418750 | TYROBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403671 | Transient overexpression lysate of TYRO protein tyrosine kinase binding protein (TYROBP), transcript variant 2 |
CNY 3080.00 |
|
| LY418750 | Transient overexpression lysate of TYRO protein tyrosine kinase binding protein (TYROBP), transcript variant 1 |
CNY 3080.00 |
|
| TP322502 | Recombinant protein of human TYRO protein tyrosine kinase binding protein (TYROBP), transcript variant 1, 20 µg |
CNY 2900.00 |
