DPPA5 (NM_001025290) Human Mass Spec Standard
CAT#: PH322509
DPPA5 MS Standard C13 and N15-labeled recombinant protein (NP_001020461)
View other "DPPA5" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | DPPA5 MS Standard C13 and N15-labeled recombinant protein (NP_001020461) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222509 |
Predicted MW | 13.3 kDa |
Protein Sequence |
>RC222509 representing NM_001025290
Red=Cloning site Green=Tags(s) MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001020461 |
RefSeq Size | 612 |
RefSeq ORF | 348 |
Synonyms | ESG1 |
Locus ID | 340168 |
Cytogenetics | 6q13 |
Summary | This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400405 | DPPA5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400405 | Transient overexpression lysate of developmental pluripotency associated 5 (DPPA5) |
CNY 3080.00 |
|
TP322509 | Recombinant protein of human developmental pluripotency associated 5 (DPPA5), 20 µg |
CNY 2900.00 |