MSMP (NM_001044264) Human Mass Spec Standard
CAT#: PH322527
MSMP MS Standard C13 and N15-labeled recombinant protein (NP_001037729)
View other "MSMP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | MSMP MS Standard C13 and N15-labeled recombinant protein (NP_001037729) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222527 |
| Predicted MW | 14.99 kDa |
| Protein Sequence |
>RC222527 representing NM_001044264
Red=Cloning site Green=Tags(s) MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWLRKDCFHCTCL HPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPDPEWGSANTPVPGAPAPHSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001037729 |
| RefSeq Size | 672 |
| RefSeq ORF | 417 |
| Synonyms | PSMP |
| Locus ID | 692094 |
| Cytogenetics | 9p13.3 |
| Summary | This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. [provided by RefSeq, Jan 2011] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420820 | MSMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420820 | Transient overexpression lysate of microseminoprotein, prostate associated (MSMP) |
CNY 3080.00 |
|
| TP322527 | Recombinant protein of human microseminoprotein, prostate associated (MSMP), 20 µg |
CNY 2900.00 |
