CHTF8 (NM_001039690) Human Mass Spec Standard
CAT#: PH322566
CHTF8 MS Standard C13 and N15-labeled recombinant protein (NP_001034779)
View other "CHTF8" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
Product Data | |
Description | CHTF8 MS Standard C13 and N15-labeled recombinant protein (NP_001034779) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222566 |
Predicted MW | 13.3 kDa |
Protein Sequence |
>RC222566 protein sequence
Red=Cloning site Green=Tags(s) MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPF AVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001034779 |
RefSeq Size | 2934 |
RefSeq ORF | 363 |
Synonyms | CTF8; DERPC |
Locus ID | 54921 |
Cytogenetics | 16q22.1 |
Summary | This gene encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (proliferating cell nuclear antigen) onto DNA during DNA replication and repair. This gene is ubiquitously expressed and has been shown to have reduced expression in renal and prostate tumors. Alternatively spliced transcript variants have been described. This gene has a pseudogene on chromosome X. [provided by RefSeq, Oct 2018] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421694 | CHTF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421889 | CHTF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421694 | Transient overexpression lysate of CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 4 |
CNY 3080.00 |
|
LY421889 | Transient overexpression lysate of CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 1 |
CNY 3080.00 |
|
PH322808 | CHTF8 MS Standard C13 and N15-labeled recombinant protein (NP_001035236) |
CNY 19520.00 |
|
TP322566 | Recombinant protein of human CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP322808 | Recombinant protein of human CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) (CHTF8), transcript variant 4, 20 µg |
CNY 2900.00 |