WDR51A (POC1A) (NM_015426) Human Mass Spec Standard
CAT#: PH322704
POC1A MS Standard C13 and N15-labeled recombinant protein (NP_056241)
View other "WDR51A" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | POC1A MS Standard C13 and N15-labeled recombinant protein (NP_056241) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222704 |
| Predicted MW | 45 kDa |
| Protein Sequence |
>RC222704 protein sequence
Red=Cloning site Green=Tags(s) MAAPCAEDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFS PSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFS LSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNT VKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFS RTGEYFASGGSDEQVMVWKSNFDIVDHGEVTKVPRPPATLASSMGNLPEVDFPVPPGRGRSVESVQSQPQ EPVSVPQTLTSTLEHIVGQLDVLTQTVSILEQRLTLTEDKLKQCLENQQLIMQRATP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_056241 |
| RefSeq Size | 2213 |
| RefSeq ORF | 1221 |
| Synonyms | PIX2; SOFT; WDR51A |
| Locus ID | 25886 |
| Cytogenetics | 3p21.2 |
| Summary | POC1 proteins contain an N-terminal WD40 domain and a C-terminal coiled coil domain and are part of centrosomes. They play an important role in basal body and cilia formation. This gene encodes one of the two POC1 proteins found in humans. Mutations in this gene result in short stature, onychodysplasia, facial dysmorphism, and hypotrichosis (SOFT) syndrome. [provided by RefSeq, Sep 2012] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414586 | POC1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431870 | POC1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414586 | Transient overexpression lysate of WD repeat domain 51A (WDR51A), transcript variant 1 |
CNY 3080.00 |
|
| LY431870 | Transient overexpression lysate of POC1 centriolar protein homolog A (Chlamydomonas) (POC1A), transcript variant 2 |
CNY 3080.00 |
|
| TP322704 | Recombinant protein of human WD repeat domain 51A (WDR51A), 20 µg |
CNY 2900.00 |
