MCK10 (DDR1) (NM_013993) Human Mass Spec Standard
CAT#: PH322767
DDR1 MS Standard C13 and N15-labeled recombinant protein (NP_054699)
View other "MCK10" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DDR1 MS Standard C13 and N15-labeled recombinant protein (NP_054699) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222767 |
| Predicted MW | 100.9 kDa |
| Protein Sequence |
>RC222767 representing NM_013993
Red=Cloning site Green=Tags(s) MGPEALSSLLLLLLVASGDADMKGHFDPAKCRYALGMQDRTIPDSDISASSSWSDSTAARHSRLESSDGD GAWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMGWKDRWGQEV ISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAVYL NDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAF QAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRF LFAGPWLLFSEISFISDVVNNSSPALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILI GCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPPPYQEPRPR GNPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQAYSGDYMEPEKPGAPLLPP PPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVD SPQDLVSLDFPLNVRKGHPLLVAVKILRPDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMI TDYMENGDLNQFLSAHQLEDKAAEGAPGDGQAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATR NCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLC RAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQGLYELMLRCWSRESEQRPPFSQLHRFLAEDAL NTV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_054699 |
| RefSeq Size | 3877 |
| RefSeq ORF | 2739 |
| Synonyms | CAK; CD167; DDR; EDDR1; HGK2; MCK10; NEP; NTRK4; PTK3; PTK3A; RTK6; TRKE |
| Locus ID | 780 |
| Cytogenetics | 6p21.33 |
| Summary | Receptor tyrosine kinases play a key role in the communication of cells with their microenvironment. These kinases are involved in the regulation of cell growth, differentiation and metabolism. The protein encoded by this gene belongs to a subfamily of tyrosine kinase receptors with homology to Dictyostelium discoideum protein discoidin I in their extracellular domain, and that are activated by various types of collagen. Expression of this protein is restricted to epithelial cells, particularly in the kidney, lung, gastrointestinal tract, and brain. In addition, it has been shown to be significantly overexpressed in several human tumors. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400719 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415575 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC415576 | DDR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY400719 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 2 |
CNY 3080.00 |
|
| LY415575 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1 |
CNY 4840.00 |
|
| LY415576 | Transient overexpression lysate of discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 3 |
CNY 4840.00 |
|
| PH322819 | DDR1 MS Standard C13 and N15-labeled recombinant protein (NP_054700) |
CNY 19520.00 |
|
| TP322767 | Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP322819 | Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP700161 | Purified recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6650.00 |
|
| TP710141 | Recombinant protein of human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, residues 21-417aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
|
| TP710264 | Purified recombinant protein of Human discoidin domain receptor tyrosine kinase 1 (DDR1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |

