p38 (MAPK14) (NM_139014) Human Mass Spec Standard
CAT#: PH322774
MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620583)
View other "p38" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 3490.00
CNY 3080.00
Specifications
| Product Data | |
| Description | MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620583) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222774 |
| Predicted MW | 35.3 kDa |
| Protein Sequence |
>RC222774 representing NM_139014
Red=Cloning site Green=Tags(s) MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYR ELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKY IHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVG CIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESLSTCWRRCLYWTQIRELQRPKPLHMP TLLSTTILMMNQWPILMISPLKAGTSL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_620583 |
| RefSeq Size | 3679 |
| RefSeq ORF | 921 |
| Synonyms | CSBP; CSBP1; CSBP2; CSPB1; EXIP; Mxi2; p38; p38ALPHA; PRKM14; PRKM15; RK; SAPK2A |
| Locus ID | 1432 |
| Cytogenetics | 6p21.31 |
| Summary | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400523 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408439 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC408440 | MAPK14 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400523 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 1 |
CNY 3080.00 |
|
| LY408439 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 2 |
CNY 3080.00 |
|
| LY408440 | Transient overexpression lysate of mitogen-activated protein kinase 14 (MAPK14), transcript variant 3 |
CNY 3080.00 |
|
| PH306605 | MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_620581) |
CNY 19520.00 |
|
| PH317425 | MAPK14 MS Standard C13 and N15-labeled recombinant protein (NP_001306) |
CNY 19520.00 |
|
| TP306605 | Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP317425 | Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP322774 | Recombinant protein of human mitogen-activated protein kinase 14 (MAPK14), transcript variant 4, 20 µg |
CNY 2900.00 |
