PPM1B (NM_177968) Human Mass Spec Standard
CAT#: PH322782
PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808907)
View other "PPM1B" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808907) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222782 |
| Predicted MW | 42.6 kDa |
| Protein Sequence |
>RC222782 representing NM_177968
Red=Cloning site Green=Tags(s) MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANY CSTHLLEHITTNEDFRAAGKSGSALELSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMIS PKHIYFINCGDSRAVLYRNGQVCFSTQDHKPCNPREKERIQNAGGSVMIQRVNGSLAVSRALGDYDYKCV DGKGPTEQLVSPEPEVYEILRAEEDEFIILACDGIWDVMSNEELCEYVKSRLEVSDDLENVCNWVVDTCL HKGSRDNMSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNL PPGGGLAGKRNVIEAVYSRLNPHRESDGGAGDLEDPW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_808907 |
| RefSeq Size | 3850 |
| RefSeq ORF | 1161 |
| Synonyms | PP2C-beta; PP2C-beta-X; PP2CB; PP2CBETA; PPC2BETAX |
| Locus ID | 5495 |
| Cytogenetics | 2p21 |
| Summary | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent kinases (CDKs), and thus may be involved in cell cycle control. Overexpression of this phosphatase is reported to cause cell-growth arrest or cell death. Alternative splicing results in multiple transcript variants encoding different isoforms. Additional transcript variants have been described, but currently do not represent full-length sequences. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Phosphatase, Stem cell - Pluripotency |
| Protein Pathways | MAPK signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406063 | PPM1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419156 | PPM1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC422387 | PPM1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406063 | Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 2 |
CNY 3080.00 |
|
| LY419156 | Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 1 |
CNY 4840.00 |
|
| LY422387 | Transient overexpression lysate of protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 4 |
CNY 3080.00 |
|
| PH309425 | PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_808908) |
CNY 19520.00 |
|
| PH312918 | PPM1B MS Standard C13 and N15-labeled recombinant protein (NP_002697) |
CNY 19520.00 |
|
| TP309425 | Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP312918 | Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP322782 | Recombinant protein of human protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform (PPM1B), transcript variant 2, 20 µg |
CNY 2900.00 |
