SLC25A3 (NM_005888) Human Mass Spec Standard
CAT#: PH322824
SLC25A3 MS Standard C13 and N15-labeled recombinant protein (NP_005879)
View other "SLC25A3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | SLC25A3 MS Standard C13 and N15-labeled recombinant protein (NP_005879) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222824 |
| Predicted MW | 40.09 kDa |
| Protein Sequence |
>RC222824 representing NM_005888
Red=Cloning site Green=Tags(s) MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYGSGRFFILCGL GGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGF YEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKE EGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIV SHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEM PESLKKKLGLTQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005879 |
| RefSeq Size | 1688 |
| RefSeq ORF | 1086 |
| Synonyms | OK/SW-cl.48; PHC; PTP |
| Locus ID | 5250 |
| Cytogenetics | 12q23.1 |
| Summary | The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403888 | SLC25A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417005 | SLC25A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419206 | SLC25A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403888 | Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3080.00 |
|
| LY417005 | Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY419206 | Transient overexpression lysate of solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| TP322824 | Recombinant protein of human solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 (SLC25A3), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
其它SLC25A3产品
