GPBP1 (NM_022913) Human Mass Spec Standard
CAT#: PH322826
GPBP1 MS Standard C13 and N15-labeled recombinant protein (NP_075064)
View other "GPBP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | GPBP1 MS Standard C13 and N15-labeled recombinant protein (NP_075064) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222826 |
Predicted MW | 53.3 kDa |
Protein Sequence |
>RC222826 protein sequence
Red=Cloning site Green=Tags(s) MAQHDFAPAWLNFPTPPSSTKSSLNFEKHSENFAWTENRYDVNRRRHNSSDGFDSAIGRPNGGNFGRKEK NGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIPDNETGRKEDKRERKQFEAEDFPSL NPEYEREPNHNKSLAAGVWEYPPNPKSRAPRMLVIKKGNTKDLQLSGFPVVGNLPSQPVKNGTGPSVYKG LVPKPAAPPTKPTQWKSQTKENKVGTSFPHESTFGVGNFNAFKSTAKNFSPSTNSVKECNRSNSSSPVDK LNQQPRLTKLTRMRTDKKSEFLKALKRDRVEEEHEDESRAGSEKDDDSFNLHNSNSTHQERDINRNFDEN EIPQENGNASVISQQIIRSSTFPQTDVLSSSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISE QLQKNGLRKNGILKNGLICDFKFGPWKNSTFKPTTENDDTETSSSDTSDDDDV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_075064 |
RefSeq Size | 4633 |
RefSeq ORF | 1419 |
Synonyms | GPBP; SSH6; VASCULIN |
Locus ID | 65056 |
Cytogenetics | 5q11.2 |
Summary | This gene was originally isolated by subtractive hybridization of cDNAs expressed in atherosclerotic plaques with a thrombus, and was found to be expressed only in vascular smooth muscle cells. However, a shorter splice variant was found to be more ubiquitously expressed. This protein is suggested to play a role in the development of atherosclerosis. Studies in mice suggest that it may also function as a GC-rich promoter-specific trans-activating transcription factor. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411462 | GPBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC426732 | GPBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426733 | GPBP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411462 | Transient overexpression lysate of GC-rich promoter binding protein 1 (GPBP1), transcript variant 1 |
CNY 4840.00 |
|
LY426732 | Transient overexpression lysate of GC-rich promoter binding protein 1 (GPBP1), transcript variant 2 |
CNY 3080.00 |
|
LY426733 | Transient overexpression lysate of GC-rich promoter binding protein 1 (GPBP1), transcript variant 3 |
CNY 3080.00 |
|
TP322826 | Recombinant protein of human GC-rich promoter binding protein 1 (GPBP1), transcript variant 1, 20 µg |
CNY 2900.00 |