JNK1 (MAPK8) (NM_139046) Human Mass Spec Standard
CAT#: PH322829
MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620634)
View other "JNK1" proteins (16)
| Need it in bulk or customized? Get a free quote | 
CNY 14250.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 3080.00
Specifications
| Product Data | |
| Description | MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620634) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC222829 | 
| Predicted MW | 43.8 kDa | 
| Protein Sequence | >RC222829 representing NM_139046 Red=Cloning site Green=Tags(s) MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRA YRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIK HLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWS VGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLF PADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIE EWKELIYKEVMDLEERTKNGVIRGQPSPLAQVQQ myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_620634 | 
| RefSeq Size | 1417 | 
| RefSeq ORF | 1152 | 
| Synonyms | JNK; JNK-46; JNK1; JNK1A2; JNK21B1/2; PRKM8; SAPK1; SAPK1c | 
| Locus ID | 5599 | 
| Cytogenetics | 10q11.22 | 
| Summary | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Apr 2016] | 
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase | 
| Protein Pathways | Adipocytokine signaling pathway, Colorectal cancer, Epithelial cell signaling in Helicobacter pylori infection, ErbB signaling pathway, Fc epsilon RI signaling pathway, Focal adhesion, GnRH signaling pathway, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway, Type II diabetes mellitus, Wnt signaling pathway | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400970 | MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC408400 | MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LC408401 | MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 1470.00 | |
| LC408403 | MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 1470.00 | |
| LC430088 | MAPK8 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY400970 | Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1 | CNY 3080.00 | |
| LY408400 | Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1 | CNY 3080.00 | |
| LY408401 | Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2 | CNY 4840.00 | |
| LY408403 | Transient overexpression lysate of mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2 | CNY 4840.00 | |
| PH318407 | MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_002741) | CNY 19520.00 | |
| PH322874 | MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620635) | CNY 19520.00 | |
| PH322925 | MAPK8 MS Standard C13 and N15-labeled recombinant protein (NP_620637) | CNY 19520.00 | |
| TP318407 | Recombinant protein of human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP322829 | Purified recombinant protein of Homo sapiens mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b1, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP322874 | Recombinant protein of human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-b2, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP322925 | Recombinant protein of human mitogen-activated protein kinase 8 (MAPK8), transcript variant JNK1-a2, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        


 
        