UNG (NM_080911) Human Mass Spec Standard
CAT#: PH322868
UNG MS Standard C13 and N15-labeled recombinant protein (NP_550433)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | UNG MS Standard C13 and N15-labeled recombinant protein (NP_550433) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222868 |
| Predicted MW | 34.5 kDa |
| Protein Sequence |
>RC222868 representing NM_080911
Red=Cloning site Green=Tags(s) MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQ LDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQM CDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVL LLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSP LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_550433 |
| RefSeq Size | 2053 |
| RefSeq ORF | 939 |
| Synonyms | DGU; HIGM4; HIGM5; UDG; UNG1; UNG2; UNG15 |
| Locus ID | 7374 |
| Cytogenetics | 12q24.11 |
| Summary | This gene encodes one of several uracil-DNA glycosylases. One important function of uracil-DNA glycosylases is to prevent mutagenesis by eliminating uracil from DNA molecules by cleaving the N-glycosylic bond and initiating the base-excision repair (BER) pathway. Uracil bases occur from cytosine deamination or misincorporation of dUMP residues. Alternative promoter usage and splicing of this gene leads to two different isoforms: the mitochondrial UNG1 and the nuclear UNG2. The UNG2 term was used as a previous symbol for the CCNO gene (GeneID 10309), which has been confused with this gene, in the literature and some databases. [provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency |
| Protein Pathways | Base excision repair, Primary immunodeficiency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408998 | UNG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418736 | UNG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408998 | Transient overexpression lysate of uracil-DNA glycosylase (UNG), transcript variant 2 |
CNY 3080.00 |
|
| LY418736 | Transient overexpression lysate of uracil-DNA glycosylase (UNG), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| TP322868 | Recombinant protein of human uracil-DNA glycosylase (UNG), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP760178 | Recombinant protein of human uracil-DNA glycosylase (UNG), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
