H2BU1 (NM_175055) Human Mass Spec Standard
CAT#: PH322960
HIST3H2BB MS Standard C13 and N15-labeled recombinant protein (NP_778225)
View other "H2BU1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HIST3H2BB MS Standard C13 and N15-labeled recombinant protein (NP_778225) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222960 |
Predicted MW | 13.9 kDa |
Protein Sequence |
>RC222960 protein sequence
Red=Cloning site Green=Tags(s) MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDI FERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_778225 |
RefSeq Size | 452 |
RefSeq ORF | 378 |
Synonyms | H2Bb; HIST3H2BB |
Locus ID | 128312 |
Cytogenetics | 1q42.13 |
Summary | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq, Aug 2015] |
Protein Pathways | Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406379 | HIST3H2BB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406379 | Transient overexpression lysate of histone cluster 3, H2bb (HIST3H2BB) |
CNY 3080.00 |
|
TP322960 | Recombinant protein of human histone cluster 3, H2bb (HIST3H2BB), 20 µg |
CNY 2900.00 |