SPTLC1 (NM_006415) Human Mass Spec Standard
CAT#: PH322985
SPTLC1 MS Standard C13 and N15-labeled recombinant protein (NP_006406)
View other "SPTLC1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | SPTLC1 MS Standard C13 and N15-labeled recombinant protein (NP_006406) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222985 |
Predicted MW | 52.6 kDa |
Protein Sequence |
>RC222985 representing NM_006415
Red=Cloning site Green=Tags(s) MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLV PPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYG TFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFK HNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFG VLGEHGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAI EALNIMEENPGIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCM NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006406 |
RefSeq Size | 2780 |
RefSeq ORF | 1419 |
Synonyms | HSAN1; HSN1; LBC1; LCB1; SPT1; SPTI |
Locus ID | 10558 |
Cytogenetics | 9q22.31 |
Summary | This gene encodes a member of the class-II pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is the long chain base subunit 1 of serine palmitoyltransferase. Serine palmitoyltransferase converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate and is the key enzyme in sphingolipid biosynthesis. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified. Pseudogenes of this gene have been defined on chromosomes 1, 6, 10, and 13. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Metabolic pathways, Sphingolipid metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405999 | SPTLC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416663 | SPTLC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY405999 | Transient overexpression lysate of serine palmitoyltransferase, long chain base subunit 1 (SPTLC1), transcript variant 2 |
CNY 3080.00 |
|
LY416663 | Transient overexpression lysate of serine palmitoyltransferase, long chain base subunit 1 (SPTLC1), transcript variant 1 |
CNY 4840.00 |
|
TP322985 | Recombinant protein of human serine palmitoyltransferase, long chain base subunit 1 (SPTLC1), transcript variant 1, 20 µg |
CNY 2900.00 |