CES2 (NM_198061) Human Mass Spec Standard
CAT#: PH323021
CES2 MS Standard C13 and N15-labeled recombinant protein (NP_932327)
View other "CES2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CES2 MS Standard C13 and N15-labeled recombinant protein (NP_932327) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223021 |
| Predicted MW | 66.9 kDa |
| Protein Sequence |
>RC223021 representing NM_198061
Red=Cloning site Green=Tags(s) MTAQSRSPTTPTFPGPSQRTPLTPCPVQTPRLGKALIHCWTDPGQPLGEQQRVRRQRTETSEPTMRLHRL RARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRFAPP EPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWI HGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFG GNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSE ALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRI YDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPALQVAHF QCSRAPVYFYEFQHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFD QEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_932327 |
| RefSeq Size | 3909 |
| RefSeq ORF | 1821 |
| Synonyms | CE-2; CES2A1; iCE; PCE-2 |
| Locus ID | 8824 |
| Cytogenetics | 16q22.1 |
| Summary | This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. The protein encoded by this gene is the major intestinal enzyme and functions in intestine drug clearance. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Oct 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Drug metabolism - other enzymes |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401274 | CES2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405086 | CES2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY401274 | Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1 |
CNY 3080.00 |
|
| LY405086 | Transient overexpression lysate of carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2 |
CNY 4840.00 |
|
| PH303009 | CES2 MS Standard C13 and N15-labeled recombinant protein (NP_003860) |
CNY 19520.00 |
|
| TP303009 | Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP323021 | Recombinant protein of human carboxylesterase 2 (intestine, liver) (CES2), transcript variant 2, 20 µg |
CNY 2900.00 |
