Pirin (PIR) (NM_003662) Human Mass Spec Standard
CAT＃: PH323111
PIR MS Standard C13 and N15-labeled recombinant protein (NP_003653)
View other "Pirin" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | PIR MS Standard C13 and N15-labeled recombinant protein (NP_003653) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223111 |
| Predicted MW | 31.9 kDa |
| Protein Sequence |
>RC223111 representing NM_003662
Red=Cloning site Green=Tags(s) MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEG GSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIP KPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQ KIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFER AKTWKSKIGN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003653 |
| RefSeq Size | 1316 |
| RefSeq ORF | 870 |
| Locus ID | 8544 |
| Cytogenetics | Xp22.2 |
| Summary | This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401212 | PIR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422656 | PIR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401212 | Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 1 |
CNY 3080.00 |
|
| LY422656 | Transient overexpression lysate of pirin (iron-binding nuclear protein) (PIR), transcript variant 2 |
CNY 3080.00 |
|
| PH300626 | PIR MS Standard C13 and N15-labeled recombinant protein (NP_001018119) |
CNY 19520.00 |
|
| TP300626 | Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323111 | Recombinant protein of human pirin (iron-binding nuclear protein) (PIR), transcript variant 1, 20 µg |
CNY 2900.00 |
